Die leerpraktykvorming van hoërskoolleerders op ’n plattelandse werkersklasdorp

  • 1

Die leerpraktykvorming van hoërskoolleerders op ’n plattelandse werkersklasdorp

Aslam Fataar, Vise-Dekaan: Navorsing van die Fakulteit Opvoedkunde, Universiteit Stellenbosch en Henry Fillies, post-doktorale student by Fakulteit Opvoedkunde, Universiteit Stellenbosch

LitNet Akademies Jaargang 13(2)
ISSN 1995-5928

 

Opsomming

Gegrond op etnografiese metodes bespreek hierdie artikel die leerpraktykvorming van plattelandse werkersklasleerders in en oor hul leerruimtes heen. Ons huldig die mening dat alhoewel die invloed van armoede op die opvoedkundige geleenthede van landelike leerders belangrik is, armoede nie die deurslaggewende faktor om is die verskille in die opvoedkundige geleenthede en uitkomste tussen stedelike en landelike leerders te verklaar nie. Die doel met hierdie artikel is om te toon hoe arm plattelandse werkersklasleerders hul woonbuurtomstandighede gebruik om hul leerpraktyke te bou. Wat ons dus bied, is ’n bespreking van hoe landelike werkersklasleerders betrokke raak by die vorming van hul leerpraktyke in hul verarmde woonbuurt. Ons belangrikste uitgangspunt is die siening dat daar ’n gaping tussen die ryk opvoedkundige verbintenisse van plattelandse werkersklasleerders, soos hierdie leerders, en hul leefwêreld buite die skool is. Die gevolg is dat die perspektief heers dat hierdie leerders dikwels ontkoppel is van hul opvoedkundige prosesse. Hierdie artikel bied dus ’n ontleding van die wyses, sowel as die “ruimtelike” en konseptuele grondslag, waarop hulle hul leerpraktyke bou. Ons voer aan dat arm plattelandse werkersklasleerders sterk refleksief met hul omstandighede omgaan tot die bou van hul leerpraktyke. Ons wend ons tot Bourdieu (1977, 1986, 2006) se sosiologiese konsepte van habitus, veld, praktyke en kapitaal as teoretiese lense om die aangeleenthede van hul leerpraktykvorming te verwoord. Sentraal tot ons bespreking is die invloed van hierdie leerders se habitusvorming, dit wil sê die rol wat hul optredes, interaksies en denke in verhouding tot hul leerpraktykvorming speel. Die gevolg is dat hulle strategieë implementeer en ontwikkel, en ook netwerke skep, om hul leerpraktyke in hul omstandighede te bou. Dit is hierdie aangeleenthede wat hulle in staat stel om op koers te bly met betrekking tot hul opvoedkundige prosesse.

Trefwoorde: etnografie; leerpraktyke; leerpraktykvorming; opvoedkundige praktyke; plattelandse werkersklasdorp; verarmde omgewing

 

Abstract

The learning practice formation of high school learners in a rural working class town

This article discusses the learning practices of five learners in an impoverished rural settlement in the Western Cape province of South Africa. It responds to the following question: How do rural working class learners construct their learning practices in their neighbourhood context? This article does not focus on school learning. Instead, the focus is on the learners’ navigations in the “lived” environs of their neighbourhood and the ways in which they use their neighbourhood’s resources to establish a productive aspirant educational route. We discuss their dynamic interaction with their everyday networks, literacies, and other discursive materials in the neighbourhood as a means of exercising and establishing their learning agency.

This article challenges popular perceptions about the educational paths of learners in impoverished contexts which portray them as victims of the impoverished circumstances and as lacking in the necessary cultural capital for educational success. On the contrary, this article illustrates how such learners are able to maximise their family and community resources in their quest for an education and, as in the case of the young people in this article, how they mediate and utilise the neighbourhood’s resources to establish learning practices in support of their education.

The article is based on ethnographic research over a two-year period (2013–2014) in a small rural town in the Western Cape. We explored how five learners went about building their learning practices in this town. We followed them into their family homes and across the neighbourhood, paying special attention to their peer relations, media-related literacies and various interactions with community members, sport and recreational programmes. We utilised semi- and unstructured individual interviews as well as focus group discussions to obtain data about their individual life stories in relation to their learning practices. These interview strategies were augmented by participant observation of their involvement in a multiplicity of informal literacy and learning encounters in their families and neighbourhood. Our research enabled us to develop insight into the learners’ socio-cultural contexts (emic perspective), in order for us to build a novel interpretation of their learning practices (the etic perspective).

The analysis of the data was informed by sociological concepts provided by Pierre Bourdieu, a French social theorist. His concepts of habitus, field, practices and capital enabled us to construct a rich and detailed account of the selected participants’ learning practices. Habitus was central to this account, which, according to Bourdieu (1993:86) refers to “the way people internalize social structures and perceive the world. … (explaining) how social agents operate in ways that are compatible with their social situations”. Habitus functions as a regulator between individuals and their external world, and it frames how individuals behave in certain situations. Bourdieu’s view of practices is important in understanding how the learners are able to behave in response to changes in their situations. “Practices”, according to Bourdieu (1977:123), are “the improvisational and pragmatic action of everyday life faced with constant problem solving”. While an individual’s social history is important in shaping his or her practices, his/her habitus is penetrable and responds to external circumstances. In other words, the habitus is continually shaped via the people’s daily practices.

This theoretical perspective allowed us to understand the learners’ attempts to build their learning practices as the outcome of dynamic practices out which their habitus evolved. We specifically focused on how they built their practices over time through the strategic use of their neighbourhood’s resources and sources of cultural and social capital, which allowed them to build a platform to support and inform their school learning. We argue that it is this out-of-school learning platform that played a decisive role in their educational progress at school, without which they might have become school drop-outs. And, what is central for understanding how they accomplish their learning platform, is their ability to navigate the various spaces of their community which constantly presented them with challenges associated with peer cultures, criminality, and drugs. They could easily have fallen victim to the negative effects of these ubiquitous challenges. The article is an explanation of their ability to build practices that mitigate the worst consequences of these negative challenges as well as the strategies they adopt to stay on course in their quest to succeed at their school learning.

The article provides an insight into the learners’ desperate and limiting life circumstances and how these impact their learning commitments. We provide an understanding of the manner in which their circumstances contributed to the ways in which they build their learning practices. These learners did not succumb to the negative influences in their communities, nor did their impoverishment prevent them from staying committed to their education. Their persistence and commitment to cultivating appropriate learning practices for school success impacted their identity formation. It can thus be said that they succeeded in developing a productive habitus via their ongoing learning practices amidst constrained circumstances.

The article also discusses the emergence of particular types of identities among the five learners, which we argue are pivotal to the manner in which they form their learning practices. Their learning identities emerged over time and were constituted out of their constant evaluation, formulation and ongoing construction of themselves as successful learners. Our observations showed that they were able to internalise the rules of what it means to be a good learner and that they take responsibility for their learning as well as developing support strategies via, for example, the use of Facebook and Mxit or peer support and encouragement. Cultivating productive learning identities played a crucial role in the formation of their learning practices.

The article finally turns to a discussion of the impact of learning ‘positioning’ on their learning practices. Here the focus is on their creative adaptation strategies in positioning themselves as productive learners. We pay particular attention to the manner in which theirlearning practices and strategies are interwoven with how they position themselves as learners. Such positioning is central to their learning practices. We argue that these learners were able to acquire a habitus in respect of their learning that enabled them to position themselves as productive learners in their impoverished neighbourhood.

In sum, the article highlights the processes involved in these learners’ attempts to build their learning practices in an impoverished rural neighbourhood. It shows that an understanding of their social lives in context is important for gaining insight into their learning aspirations and practices. Despite deeply trying circumstances they managed to stay on course in leading productive lives by keeping their education success in sight. It is the way they built their commitments to their learning, via developing strategic identities and practices, in terms of which they were able to position themselves as productive learners in their community context.

Keywords: educational practices; ethnography; impoverished environment; learning practice formation; learning practices; rural working class town; working class learners

 

1. Inleiding

In hierdie artikel bespreek ons die leerpraktykvorming van vyf leerders in ’n plattelandse nedersetting in die Wes-Kaap van Suid-Afrika. Ons beantwoord die vraag: Hoe konstrueer plattelandse werkersklasleerders hul leerpraktyke in hul woonbuurtkonteks?Ons wys daarop dat leerpraktyke” nie fokus op skoolleer nie, maar op die hulpbronne in die woonbuurt waartoe hulle hulself in hul geleefde omstandighede wend ten einde produktief by hul leer betrokke te raak. Met ander woorde, ons bespreek die interaksies van hierdie leerders met alledaagse netwerke, hulpbronne en ander diskursiewe materiaal waartoe hulle hulself wend, asook hul menslike agentskap in hul verarmde woonbuurt. Ons uitgangspunt is dat hul ervarings ’n blinde kol in die huidige akademiese geleerdheid is, of ’n onderwerp van wanvoorstelling wat bydra tot die voortbestaan van wanopvattings oor hoe arm leerders by opvoedkundige prosesse betrokke raak. Hierdie artikel daag die aannames in die huidige Suid-Afrikaanse literatuur uit dat leerders uit histories benadeelde agtergronde aan mislukkings uitgelewer is as gevolg van die gebrek aan of weens onvoldoende vorme van kulturele kapitaal.

Ons verken hoe Cherry, Ruby, Musa, Sally en Tom (skuilname) hul leerpraktyke bemiddel en bou in en oor hul geleefde ruimtes heen. Ons vernaamste vertrekpunt was nie net om te verstaan wat hul houdings teenoor hierdie leerpraktykvorming is nie, maar ook hoe hul daaglikse interaksies in en oor hul woonbuurt heen hierdie praktyke vorm wat diep gewortel is in hul breër sosio-ekonomiese konteks. Verder hou ons die argument voor dat hierdie leerders alternatiewe maniere ontwikkel wat hulle in staat stel om hul lewens suksesvol in hul omgewing te navigeer. Wat ons poog om te verduidelik is hoe die aard van hul moderne sosiale wêreld en die dinamika voortspruitend daaruit hul leerpraktyke toelig en rig. Ons poog ook om te ontbloot hoe hulle verskillende hulpbronne in hul omgewing gebruik om hul leerpraktyke te vestig. Ten slotte bied ons ’n bespreking van die belangrikheid van begrip van hierdie leerders se leerpraktyke.

In ’n vorige artikel (Fillies en Fataar 2015) het ons gefokus op hoe plattelandse werkersklasleerders se doksa (denkwyses) hulle oriënteer tot die verwerkliking van hul leerpraktyke. Die bedoeling was om ’n ontleding te bied wat bewys het dat die leerders se doksa as betekenisgewingsmiddel bydra tot die konstruksie van hul leerpraktyke. Die sleutelargument was dat dit weens hul doksa is dat hulle bepaalde vorme van oriëntasies tot leer sal wil bekom. Hul doksa het in besonder gefunksioneer as die dinamiese middel tot hul leerpraktyke in hul sosiale konteks waar daar medevormende aktiwiteite en prosesse tot hul leerpraktyke bestaan. Dit het hulle gerig om hul leerhulpbronne met verloop van hul alledaagse leeraktiwiteite te bou en te gebruik. Met ander woorde, dit was hul doksa wat hul denkprosesse met betrekking tot hoe hulle gaan leer, gevorm het en wat die manier was waarop hulle hul ervarings en omstandighede met betrekking tot die vorming van wat hulle moet leer om te kan oorleef en om suksesvol te wil wees, gevorm het.

Daar is ’n magdom nuttige navorsing wat sommige van die uitdagings tot leer en begrip van die diverse opvoedkundige ervarings van kinders in werkersklasomgewings in Suid-Afrika beklemtoon (Fataar 2007, 2009b, 2010; Soudien 2004, 2007; Swartz 2009). Van hierdie navorsers wys daarop dat kinders vanuit werkersklasagtergronde in die Suid-Afrikaanse samelewing teenstellende identiteite, wat hul leeridentiteite insluit, asook die manier waarop hulle hul skoolloopbaan sien, ontwikkel (Fataar 2007). Baie min akademiese werk fokus egter op die rekursiewe verbintenisse tussen die snelveranderende sosiale kontekste en die opvoedkundige prosesse van jongmense.

Ramphele (2002) bied in haar Steering by the stars: Being young in South Africa ’n ingrypende weergawe van tieners wat sukkel om hul ambisies te bereik te midde van ouerlike verwaarlosing, materiële teëspoed, gebrekkige skoolopleiding en die vernietigende druk van vriende en die gemeenskap. Ramphele se studie sentreer op die werklike keuses wat jongmense maak, en hoe die gevolge van hul keuses op hul lewens ontvou. Sy gee die betekenis van kinders se begrip van die wêreld deur middel van hul optrede weer en sodoende kan ons die gevolge wat dit beïnvloed, beter verstaan.

Barbarin en Richter (2001) bied ’n ontleding van kindwees in die postapartheid era. Hulle skets ’n komplekse en moeilike beeld van wat dit beteken en verg om in die skaduwee van apartheid groot te word. Verder beskryf hulle die interaksies in verbrokkelende gesinslewens en huishoudings, gemeenskapsgeweld en die sosio-emosionele ontwikkeling van kinders. “Mandela’s children”, soos hulle die kinders beskryf, moet meeding met die druk van die moderne lewe wat van hulle vereis om die tradisionele praktyke na te laat wat gehelp het om gedrag en seksualiteit te reguleer (Barbarin en Richter 2001:22). Volgens hulle is die lewens van Suid-Afrikaanse jeugdiges “an accumulation of morbidity and mortality, mood disturbances, academic underachievement, aggression, premature sexuality and child-bearing, substance abuse, delinquency, underemployment, high rates of divorce and instability of family life” (2001:22).

Portes en Rumbaut (2006) voer aan dat die omgewings waarin benadeelde groepe gevestig is, gekombineer met die woonbuurt se unieke karakter, die akademiese vooruitsigte van hul kinders vorm. Portes en Rumbaut (2006:98) noem dat baie arm werkersklaswoonbuurte eerder valstrikke is as wat dit as platforms vir opwaartse mobiliteit vir hierdie kinders funksioneer. Verskeie studies dui ook daarop dat die woonbuurte ’n sterk faktor is in die begrip van die skoolervarings van baie van hierdie jeugdiges. Dit is dan ook hierdie ervarings wat belangrike implikasies kan hê vir hoe hierdie jeugdiges met boodskappe met betrekking tot hul leerervarings onderhandel (Soudien 2007).

In ’n artikel getiteld “Fighting for a normal life: Becoming a young adult in the New South Africa” lewer Soudien (2004) kommentaar op die vloeibaarheid van die verskillende komplekse uitdagings wat die jeug in ’n “nuwe” Suid-Afrika in die gesig staar. Vir die meeste, sê hy, is grootword in Suid-Afrika ’n “dream denied, if not betrayed” (2004:53). Hy verduidelik hoe, geïnspireer deur die visie van die nuwe Suid-Afrika, die hoop en geloof van die jeug elke dag getoets word namate hulle en hul ouers sukkel om te oorleef (2004:53), en dat sekerheid vervang is deur onsekerheid en die spoed van verandering voortdurend versnel.

Fataar en Du Plooy (2012) voer aan dat Suid-Afrikaanse leerders se huidige leerbetrokkenheid bestaan uit fragmentasie van die verlede en die manier waarop kinders in die hede leef en leer. Fataar en Du Plooy wys op die feit dat as ons dink oor mense se lewens as weë “[that are] crossed over and cut across by myriad aspects, a dense fabric of life paths emerges; through time, this fabric materializes as layers atop layers atop layers, forming the layers of how their learning is shaped”. Ons handhaaf die siening dat die interaktiewe en formatiewe dinamika buite die skool ons ’n groter konseptuele vertrekpunt bied om opvoedkundige en leernavigasies van leerders te verstaan.

Dit word duidelik dat daar, in teenstelling met die literatuur wat die aandag daarop vestig dat werkersklasleerders dikwels probleme in opvoedkundige omgewings ervaar, betreklik min studies is wat die opvoedkundige stryd van hierdie leerders in hul woonbuurtkonteks ondersoek. Die leerervarings van leerders in die Suid-Afrikaanse konteks resoneer dikwels met ander literatuur gegrond op die diskriminasie en rassegeskille in hierdie jeugdiges se ervarings. Hul leerervarings kan egter nie geskei word van hierdie sosiale stigma en ander vorme van diskriminasie nie. Dikwels word dit verder gekompliseer deur botsende aangeleenthede wat verband hou met hul sosio-ekonomiese omstandighede (Soudien 2007). Dit resoneer verder in besonder met navorsing soos gedoen deur Willis (1977), wat aan die hand doen dat werkersklasleerders gesosialiseer is om sekere aspekte van die hoofstroomskoolnorme, insluitende goeie akademiese ingesteldhede en aspirasies vir tersiêre studie, weerstaan. Ander akademici voer weer aan dat institusionele praktyke algemeen ontwerp is om werkersklasjeugdiges te marginaliseer (Giroux 2009). Nog ’n aspek is dat negatiewe sosiale en kulturele oortuigings dikwels deur sosiale instellings filtreer om die manier waarop sommige jeugdiges leer, te vorm.

Hierdie artikel het ook ten doel om voort te bou en uit te brei op die werk van Fataar en Du Plooy (2012) oor die geletterdheidspraktyke van kinders by die kruispad van hul skool- en huishoudelike omstandighede wat ons ’n perspektief bied van die opvoedkundige wêrelde van werkersklasskoolkinders. Ons beweeg vanuit die veronderstelling dat die landelike jeug hul leerpraktyke op die hulpbronne van hul ervarings in hul wêreld grond. Ons fokus is nie net op die kennis in die alledaagse praktyke en skoolgebaseerde praktyke nie, maar ook op die sosiokulturele prosesse en interaksies waarby leerders betrokke raak in en oor die domeine van hul lewens heen ter vorming van hul leerpraktyke. Ons argument is dat hierdie aspekte medevormend is vir hul leerpraktyke namate hulle hul kennis met verloop van tyd opbou. Ons aanvaar ook die siening dat leer in arm sosiale kontekste kompleks is en dat daar duidelik baie konseptuele uitdagings is in ’n poging om sulke praktyke te verstaan.

Die ontleding is gegrond op etnografiese werk in en om ’n plattelandse skool, naamlik Arendsehoop (skuilnaam), in ’n plattelandse nedersetting in die Wes-Kaap. Die ontledingseenheid was vyf graad 10-leerders. ’n Verdere aspek van die ondersoek het deelnemende waarneming en kwalitatiewe werk behels om te verstaan wat die vyf kinders se leernavigasies in hul huishoudelike en woonbuurtdomeine is. Induktief ontleed, is die sleuteltemas wat uit die data oor hul geleefde domeine verkry is: (1) Die invloed van die leerders se beperkende omstandighede op hul leerpraktyke; (2) hul leeridentiteitkonstruering en praktykvorming; en (3) hul leerposisionering. Ons gebruik hierdie temas om ’n verhaal te ontwikkel oor die vorming van hierdie kinders se leerpraktyke oor hul onderskeie leerdomeine heen. Ons wil aanvoer dat hierdie temas ons nader aan ’n verklaring bring van die manier waarop plattelandse werkersklasleerders hul leerpraktyke vorm.

Vervolgens bied ons eers ’n bespreking van die teoretiese benadering waarteen die konstruering van plattelandse werkersklasleerders se leerpraktykvorming in hul woonbuurtkonteks verstaan moet word.

 

2. Teoretiese oorwegings

In hierdie afdeling word die sosiologiese konsepte van habitus, veld, praktyke en kapitaal van Pierre Bourdieu as teoretiese lens aangebied. Hierdeur wil ons ’n verband lê tussen hierdie konsepte en die fokus van hierdie artikel, naamlik hoe plattelandse werkersklasleerders se leerpraktyke in hul woonbuurtkonteks konstrueer. Bourdieu se konsepte bied ons ’n nuttige grondslag vir die analitiese lense wat ons aanwend om ons navorsing te interpreteer.

Habitus is sentraal tot ons argument. Volgens Bourdieu (1986:24) is daar ook verskillende vorme van kapitaal, onder andere ekonomiese, kulturele en sosiale kapitaal en bepaal die verspreiding van kapitaal tussen individue hul kanse op sukses vir praktyke. Bourdieu (1986; 2006:15) verwys na kapitaal, hetsy kultureel, ekonomies of sosiaal, as ’n bron waarop mense hulle skoei om hul status in die samelewing te bevorder of in stand te hou. Dit bepaal regstreeks die kanse op sukses binne praktyke (Bourdieu 2006:15).

Met verwysing na kulturele kapitaal noem Bourdieu (2004) dat dit die kennis van en vertroudheid met gesogte vorme van kulturele uitdrukkings is. Alhoewel kulturele kapitaal met verloop van tyd opgebou kan word, vloei dit vanuit die habitus van ’n persoon (Bourdieu en Passeron 1977:94), wat Bourdieu definieer as ’n komplekse wisselwerking tussen die verlede en die hede. Hy noem dat habitus “na iets histories, wat gekoppel is aan individue se geskiedenis” verwys (Bourdieu 1993:86).

Lingard en Christie (2003:320) verwoord dit soos volg:

… the concept of habitus, that is, the way people internalize social structures and perceive the world – their unconscious schemes of perception – that embody extant historical structures. This is Bourdieu’s concept of habitus, which addresses how social agents operate in ways that are compatible with their social situations.

In wese funksioneer die habitus as ’n reguleerder tussen individue en hul eksterne wêreld. Wacquant (1992 in Bourdieu en Wacquant 1992) argumenteer dat habitus die skakeling tussen individue en hul sosiale wêrelde is. Dit (habitus) beskik oor die vermoë om die individue op sekere maniere te laat dink en optree (Jenkins 1992:4–84). Habitus is ’n redelik komplekse konsep wat beskryf kan word as ’n stelsel van gesindhede wat gegenereer en herskep word (soms onwetend) deur middel van sosiale interaksie en praktyke. Bourdieu (1977) noem daardie praktyke “praxis, the improvisational and pragmatic action of everyday life faced with constant problem solving”. Vir ons is die konsep van habitus nie net belangrik omdat Bourdieu dit koppel aan sosiale interaksie en praktyke van sosiale strukture nie, maar ook omdat hy dit laat aansluit by ruimtelike dimensies en mensgemaakte omgewings in sy beskrywing van habitus en hoe dit werk.

In sy werk gebruik Bourdieu (1979) die huishoudings van die Kabyle (’n Algerynse etniese groep) as ’n voorbeeld om te toon hoe die inwoners se gedragspatrone en sosiale strukture nie net die gevolg van onbewustelike verstandelike prosesse is nie, maar geleer word deur middel van sosiale interaksie, praktyk en ruimtelike aangeleenthede binne die huis. Weens Bourdieu se fokus op die Kabyle-huis kan sy idees, veral sy idees oor sosiale interaksie, praktyke, en die produksie en reproduksie van sosiale strukture aangewend word om ander groepe van tipes omgewings (velde) te beskryf. Individue se geskiedenis is dus noodsaaklik om die konsep habitus te verstaan. Terselfdertyd is hul habitus deurdringbaar en reageer dit op wat rondom hulle aangaan (Reay 2004). Huidige omstandighede is nie net daar om op te reageer nie, maar word geïnternaliseer en so word nog ’n laag ter toevoeging tot die vroeër vorme van sosialisering gebou (Bourdieu en Wacquant 1992:134).

Deur Bourdieu se teoretiese lense van habitus, veld en praktyke, en met verwysing na kapitaal, of soos Yosso (2005) dit stel, die kulturele rykdom van gemeenskappe, kyk ons dus na hoe arm, landelike werkersklasleerders hul leerpraktyke bou te midde van moeilike omstandighede. Waarop ons fokus, is wat algemeen beskou word as die leerpraktyke voortspruitend uit leerders se optrede en onderhandelings daarmee (dit wil sê leerpraktyke wat spruit uit aangeleenthede buite die skool). In werklikheid is alle kennis en praktyke voortspruitend daaruit kultureel. Alle kennis hou verband met ons ervarings in die sosiale en kulturele wêrelde wat ons bewoon, en ons verkry alle kennis soos dit is deur middel van sosiale en kulturele stelsels en instellings deur die sosialisering van norme, waardes, konvensies en gebruike. Ons fokus spesifiek op hoe plattelandse werkersklasleerders met verloop van tyd hul woonbuurtkonteks se beskikbare hulpbronne gebruik en vorme van kapitaal verpersoonlik waar hulle dit gebruik om ’n platform te skep van waar hulle in staat is om in hul skoolopleiding betrokke te raak. Die sleutel tot die studie is die voorafgaande sosialiseringsprosesse van hierdie leerders in verhouding tot die bou van hul leerpraktyke. Dit is ’n belangrike fokus ten einde die dinamiese verhouding tussen die leerders se ruimtelike dinamika en hoe hulle hul leerpraktyke in hul omgewing bou, te verstaan.

Wat ons vervolgens bied is die metode wat ons gebruik ter insameling van die data wat in hierdie artikel gebruik word.

 

3. Metodologie

Die data van hierdie artikel is afkomstig van ’n groter studie (Fillies 2015) oor die sosiale en opvoedkundige ervarings van Suid-Afrikaanse landelike werkersklasjeugdiges in hul landelike gemeenskap. Hierdie navorsing is toegelig deur deelnemende waarnemings en onderhoude tydens die 2013–2014-skooljaar by Arendsehoop. Etnografiese metodes is vir hierdie studie gekies. Hierdie metodes het ons die middele gebied vir die totstandkoming van skynbare en verborge persepsies en praktyke van die leerders met betrekking tot hul leerpraktykontwikkeling. Ons wou die kleinste kwessies “lees”, soos die interaksies en gebeure wat bydraend is tot die leerders se leerpraktykvorming. ’n Aansienlike tyd (18 maande) is in die veld deurgebring om die leefwyses en komplekse aspekte van toepassing op ons studie waar te neem. Ons doel met etnografie as ’n navorsingsmetode in hierdie studie was tweeledig: (1) om die sosiale en kulturele lewe van die leerders in hul sosiale en kulturele leefwêrelde te beskryf en te verstaan (genoem die emiese perspektief); en (2) om te bou op die besonderhede en begrip van hul sosiale en kulturele wêrelde om ’n nuwe sosiokulturele perspektief te ontwikkel (genoem die etiese perspektief). Ons etnografiese ondersoek het dit dus vir ons moontlik gemaak om die gebeure in die konteks waarin dit plaasvind, te verstaan.

Ons plaas ons navorsing in ’n interpretatiewe teoretiese paradigma. Wat van belang was, was dat ons die leerders se weergawes rakende die vorming van hul leerpraktyke wou verken, verstaan en interpreteer. Gubrium en Holstein (in Denzin en Lincoln 2003) beskryf ’n interpretatiewe praktyk as ’n praktyk wat betrokke is by sowel die hoe as die wat van sosiale werklikhede. Ons doel was om aan vyf geselekteerde leerders die geleentheid te bied om hulself te weerspieël soos hulle is, soos hulle wens hulle kan wees en soos hulle dink ander hulle moontlik voorstel om te wees.

Gedurende die eerste vier maande is heelwat tyd in die buurt bestee, wat waardevol was om onsself vertroud met die omgewing, sy uitleg en ander belangrike plekke wat vir ons studie van belang was, te maak. Ons waarnemings het gefokus op ’n paar van die kernleerverbintenisse van die leerders in die buurt. Ons het maklik ingeskakel met die meeste van die buitemuurse aktiwiteite in die omgewing. Dit het ons toegelaat om informele individuele onderhoude met die leerders te voer deur middel van doelgerigte steekproefnemingtegnieke, en van die 50 leerders met wie ons aanvanklik onderhoude vir die studie gevoer het, is die stemme van vyf gekies om die grondslag van hierdie artikel te vorm.

Gefokuste semigestruktureerde persoonlike onderhoude is gebruik om inligting in te samel deur na die leerders se stories oor hul eie leefwêreld te luister, om dit moontlik te maak om elkeen se storie oor hul sosiale leefwêreld in verhouding tot hul leerpraktyke te konstrueer. Op hierdie wyse is plaaslike verhale oor wat dit verg om ’n leerder in ’n werkersklaswoonbuurt te wees, verbind aan die kritiese ontleding van die leerders se leerpraktykontwikkeling. Om die hoeveelheid irrelevante inligting te minimaliseer, is daar van ’n onderhoudskedule gebruik gemaak om die onderhoude te rig. Hierdie skedule het bestaan uit ’n stel voorafbepaalde vrae. Die vrae op die skedule het ’n logiese volgorde gevolg en was neutraal, eerder as waardegedrewe van aard. Om te verseker dat die deelnemers die geleentheid kry om hulself vrylik uit te druk, is daar gebruik gemaak van wat De Vos, Strydom, Fouché, Poggenpoel, Schurink en Schurink (2005:297) oopvrae noem. Om sekere aspekte uit te lig, is die tegniek van fokusseringaangewend om deelnemers se reaksie op spesifieke aangeleenthede te verkry.

Die deelnemers is gekies deur van ’n doelgerigte steekproef gebruik te maak, gegrond op hul bereidwilligheid om aan die navorsing deel te neem. Die deelnemers met die skuilname Cherry, Ruby, Musa, Sally en Tom is gekies op grond van twee ongestruktureerde onderhoude met leerders wat positief ingestel is teenoor hul skolingsprosesse en uitstaande skooluitslae behaal. Voorts was hulle gewillig om hul lewenservarings met betrekking tot hul aspirerende weë maklik te deel en te beskryf. Hulle dra ook kennis van die woonbuurtdinamika en gemeenskapsinvloede in die gemeenskap wat moontlik hul leerpraktyke beïnvloed.

Inligting is ingesamel deur ’n reeks onderhoude met die vyf leerders te voer, wat gefokus het op hul siening van die woonbuurt in verhouding tot hul leerpraktyke en hoe hulle hul leerpraktyke verwerklik. ’n Kombinasie van sorgvuldige waarnemings, oop vrae en semigestruktureerde onderhoudstrategieë is gebruik as data-insamelingsmetode, soos aanbeveel deur González (2005). Hierdeur het ons gepoog om die komplekse funksies van huishoudings akkuraat in hul sosiokulturele en sosio-ekonomiese kontekste weer te gee.

Ons data-ontleding was deel van ’n deurlopende en rekursiewe proses, soos beskryf deur Marshall en Rossman (2006), waar aspekte wat tydens die ontleding na vore gekom het, regdeur die studie gerig was deur daaropvolgende aspekte van ander data-insameling. Nadat veldnotas en onderhoude getranskribeer is, is hierdie data gekodeer om temas in gemeenskaplike domeine saam te voeg, soos aanbeveel deur Spradley (1979). Spradley (1979) beskryf domeine as kategorieë – voorwerpe, idees, gevoelens en gebeure – soos verstaan en waargeneem deur individue. In hierdie studie is die data met ’n spesifieke vraag in gedagte gelees: Hoe bou landelike werkersklasleerders hul leerpraktyke in hul woonbuurtkonteks? Met betrekking tot ons vraag het ons gepoog om deur ons data-aanbieding en -interpretasie die magdom netwerke waarin die leerders betrokke is, te ontbloot met betrekking tot hoe hulle in hul woonbuurtkonteks leef en leer. Ons sluit aan by Fataar en Du Plooy (2012:5), wat hulle beywer vir die aanvaarding van “a fully relational perspective trained on how learning and mobility come into being, or are positioned in a nexus of relations connected to the classroom” (die woonbuurt in die geval van ons studie). Hulle voeg verder by: die manier waarop leerders “mobilise, network and put together the learning resources across space in the course of their learning activities is crucial to developing an understanding of their learning trajectories” (Fataar en Du Plooy 2012:5).

Toestemming is vooraf skriftelik van die leerders verkry om ’n elektroniese opname van elk van die onderhoude te maak en hierdie oudiobande is gemerk. Elke onderhoud is afsonderlik getranskribeer en opgesom. Die deelnemers is verder ook vooraf ingelig dat hulle die reg het om na afloop van die onderhoude na die opname te luister om te help met die verklaring daarvan. Die data is toe op tematiese wyse benader en georganiseer. Die data is volledig en stapsgewys ontleed om betroubaarheid te verseker en die proses van kategorisering is volledig uitgevoer om konstruksiegeldigheidte verseker, soos aanbeveel deur Andrande (2009:48). Die gebruik van kodering het dit vir ons moontlik gemaak om kategorieë te skep en die verbande tussen die kategorieë bloot te lê deur te fokus op ’n geïntegreerde kern om interne geldigheidte verseker, aan die hand van Andrande (2009:49). Om die kriteria van eksterne geldigheidte verseker is die dimensies van ruimte en tyd in ag geneem om dit moontlik te maak om data wat in ’n bepaalde konteks gegenereer is, ook in ’n ander opset en tyd bruikbaar te maak. Alle etiese aangeleenthede wat van toepassing is op navorsings met minderjariges is deeglik in oorweging gebring en die toepassing daarvan is deeglik nagevolg. Die potensiële deelnemers is genoegsame inligting omtrent die studie gegee en op ’n eenvoudige manier wat maklik verstaanbaar was. Ten einde te verseker dat die deelnemers se toestemming vrywillig en ingelig was, het ons ’n duidelik geskrewe geformuleerde navorsingsprotokolvorm in hul moedertaal opgestel waarin ons alle aspekte duidelik gemaak het. Vertroulikheid en anonimiteit is verseker deurdat alle deelnemers wat by die navorsing betrokke was, verseker is dat hul identiteite onder geen omstandigheid bekend gemaak sou word nie. Ons was veral bewus van die kwesbaarheid van die minderjarige kinders wat in hierdie studie gebruik is. Dit was vir ons belangrik om vertroue met hulle te bou en hul veiligheid te verseker (Clark 2008:14).

Die data het ons in staat gestel om die ruimtelike konteks van die betrokke leerders en hul belewenis van hoe die ruimtelike konteks van hul werkersklaswoonbuurt op hul leerpraktyke inwerk, op te teken. Die leerders, as konstrueerders van hul eie werklikheid, het self aangetoon hoe die ruimtelike konteks van hul woonbuurt ’n invloed op hul leerpraktyke het.

 

4. Die invloed van die leerders se beperkende woonbuurtomstandighede op leerpraktykvorming

In hierdie afdeling poog ons om insig te bied in hoe hierdie kinders se beperkende lewensomstandighede op hul leer inwerk. Van besondere belang is hoe hul omstandighede bydra tot die manier waarop hulle hul leerpraktyke bou. Ons argument is dat hul woonbuurtervarings en onderhandelinge ’n bemiddelende rol van betekenis speel in die wyse waarop hierdie leerders hul leerpraktyke bou.

Om ’n platform te skep en om lig te werp op hierdie bespreking van die invloed van hierdie leerders se woonbuurt en hul leerpraktykvorming wil ons ons eers wend tot Masoetsa (2011) se boek Eating from one pot: The dynamics of survival in poor South African households. Ons beweegrede hiervoor is dat dit teen hierdie agtergrond is dat baie werkersklasjongmense in Suid-Afrika vandag hul leerpraktyke moet bou. In haar boek bied Masoetsa (2011:11) ’n omvattende beskrywing van wat dit van werkersklasleerders in Suid-Afrika verg om te oorleef te midde van moeilike omstandighede, waar arm gesinne dikwels gedwing word om hulle tot alternatiewe korttermynoorlewingspraktyke te wend. Sy stel dit as volg:

[They are] living through other forms of survival found in the informal economy. Money is made at home through such activities as selling wares, growing vegetables and renting out backyard space. But the money is never enough, as more of it goes towards food, electricity and water. Families consider tomatoes, rice and spices luxury items they never put in their grocery basket. Paying for electricity becomes a challenge many cannot meet, hence the ubiquitous illegal electricity connections, a feature of township life that ultimately leads authorities to act against defaulters.

Met inagneming van die fokus van ons studie het die navorsingsdeelnemers in hierdie studie ook hul omstandighede op dié besonderse wyse beskryf. Hierdie omstandighede, interaksies met familielede en sosialisering in die gemeenskap werk tot ’n sekere mate in op hoe hierdie leerders hul leerpraktyke vorm.

4.1 Cherry se beperkende woonbuurtomstandighede op leerpraktykvorming

Toe hulle gevra is oor hoe hulle hul woonbuurt sien, het Cherry genoem dat “ons baie probleme het, maar my ma sê altyd ons gaan daar deurkom en ons gaan dit maak”. Cherry noem verder:

Saans kom my ma moeg uit die werk en dan kry ek haar so jammer. Sy sal dan na my kyk en sê: “Ek wil nie dit vir jou hê nie. Dit is hoekom ek myself opoffer.” Sy doen handearbeid, want dit is die enigste ding wat sy kan doen. Sy vertel my soms dat dit moeilik is vir haar, want sy is nie baie goed geleerd nie. Sy sê ook: “Jy sien moes hoe moeilik dit gaan en ek wil nie hê julle moet deur dit gaan nie.”

Cherry se lewensomstandighede maak haar dikwels bekommerd oor die toekoms. Volgens Cherry is haar daaglikse aktiwiteite tuis soms vervelig. Deur dit daagliks te herhaal is vir haar ’n roetine. Haar lewensomstandighede plaas ook beperkings op haar sosialiseringsaktiwiteite in die gemeenskap. Cherry moes deurgaans op haar eie met haar skoolwerk aangaan omdat haar ouers haar nie veel kon help nie. Nie een van haar ouers het hoërskoolopleiding nie. Sy sê: “My pa het maar standerd 6 [graad 8]. Hy moes die skool verlaat om sy ouers te help werk op die plaas. Hulle het ook so swaar gekry en my ma … kom ons los dit maar daar.

Cherry was baie emosioneel tydens hierdie mededeling. Haar ouers verskaf egter emosionele en morele ondersteuning, maar hulle kon haar nie help met uitdagings ten opsigte van haar skoolwerk nie. Sy is feitlik die hoogste geleerde in haar huis en moes dikwels briewe wat te moeilik is vir haar ouers om te verstaan aan hulle verduidelik. Sy is vasbeslote om na matriek verder te studeer. Met die moeilike omstandighede in haar agterkop wil sy haar opvoeding gebruik as ’n middel om uit haar armoedige omstandighede te verrys.

4.2 Ruby se beperkende woonbuurtomstandighede op leerpraktykvorming

In die woonbuurt word die verloop van die lewe en die praktyke daarin algemeen as normaal aanvaar. Dikwels word die werklikheid van dít wat in die woonbuurt gebeur, verskans. Hier is die situasie egter alles behalwe normaal, want hierdie leerders moet leef te midde van armoede, dwelms en geweld. Vir hierdie leerders is dwelms ’n onvermydelike realiteit van hul lewens, en dit word gereeld met misdaad en geweld geassosieer. Dwelmhandel vind om hulle plaas en is daagliks deel van hul lewens.

Ruby het aan een van ons vertel:

Meneer sien my broer is ’n tikkop [verslaaf aan tik]. Ons het eers hiervan uitgevind toe die goed in ons huis begin verdwyn. My pa het baie met hom geskel ... hom baie kanse gegee totdat hy hom uitgesit het. Ek was vir ’n tyd bang om met hom te praat. Meneer moet sy oë gesien het [sy wys deur haar oë groot te maak]. Jy het nie geweet wat in sy kop aangaan nie. Ek het met hom gepraat en hom ook dikwels vermy, want soms wou ek ook nie sy gevoelens seer gemaak het nie. Nadat my pa hom uitgesit het, het hy by die mert [dwelmhandelaar] hier bo gaan bly en toe ons weer hoor, toe is hy in die tronk. Toe hy daar uitkom, het hy vir ’n tyd reggekom, weer by ons gebly, maar toe begin hy maar net weer met sy dinge. Hy bly nou saam met ’n meisie in die skiem [woonbuurt] en hulle sê hy verkoop dit [dwelms] vir die mert, maar ek kan nie vir meneer met sekerheid sê of dit die waarheid is nie.

Volgens Ruby se vertelling was dit aanvanklik vir haar moeilik om te aanvaar dat hierdie probleem deel van hul werklikheid is. Die wete dat haar broer aan dwelms verslaaf is en die dinge doen wat hy doen, is moeilik vir haar om te begryp. Die gevolg is dat Ruby vir haarself sekere kommunikasievaardighede aangeleer het om konfliksituasies te vermy. Sy glo dat jy eers na die ander party moet luister en dan moet jy aan ’n oplossing werk, sonder om te stry en mekaar se gevoelens seer te maak.

Net soos Ruby leef ook die ander leerders te midde van die ondenkbaarste dinge. Soms het hulle emosioneel geraak wanneer sensitiewe kwessies aangeraak is. Ons het waargeneem hoe ongemaklik en ongelukkig hulle voel wanneer hulle ons van die struikelblokke in hul woonbuurt vertel het. Hulle het genoem dat die uitwerking van hierdie beperkinge hulle dikwels verhoed om vrylik in die woonbuurt rond te beweeg. In hulle is ’n diep begeerte om te “ontsnap” uit die toestande by die huis en in die woonbuurt. Hulle smag na geleenthede om hul omstandighede te verbeter.

4.3 Musa se beperkende woonbuurtomstandighede op leerpraktykvorming

Musa gebruik sy ouers se persoonlike ervarings as ’n manier om hom te wys dat daar ’n beter lewe vir hom is. Musa noem spesifiek oor wat sy ma hom vertel van haar stryd by die werk. Hy noem aan ons:

My ma sê altyd: ‘Daar is iets altyd beter vir jou om te doen. Ek wil nie hê jy [moet] opeindig soos ek, wat in ’n fabriek werk nie. Ai! Die nagskofte. Ek kan skaars vir julle dinge gee soos ek wil.

Vir Musa is dit nie ongewoon om hom dikwels in te leef in sy ma se huidige werksomstandighede nie, wat vir hom as ’n bron van motivering dien. Uit Musa se woorde blyk dit duidelik dat sy ma haar swak werksomstandighede gebruik om haar kinders aan te moedig. Sy gebruik haar eie werklikheid as ’n middel om haar kinders te laat sien dat hulle vir hulself ’n meer positiewe toekoms moet skep.

Die beleefde ervaringe van hul ouers toon die aard van die omstandighede wat die realiteite waarin hierdie leerders leef, definieer. Binne hierdie werklikhede is hierdie leerders geleer om ’n kritiese perspektief op die betekenis van hul lewens en op die aard van die geleenthede wat vir hulle beskikbaar is, te ontwikkel. In wese ontwikkel hierdie leerders deur middel van die boodskappe wat deur hul ouers oorgedra is, ’n gevoel van veerkragtigheid om nie soos hul ouers te leef nie. Dit vestig by hulle die geloof dat ’n beter lewe alleenlik deur geleerdheid vergestalt kan word, soos in die behaal van ’n kollege- of universiteitskwalifikasie. Verder laat dit hulle ook glo dat dit hulle die geleentheid sou bied om hul ekonomiese en sosiale posisies in die samelewing te bevorder.

Al die navorsingsdeelnemers was dit egter eens dat hulle, ten spyte van hul omstandighede, steeds produktiewe lewens lei. Dit was interessant dat hulle nie, soos dit algemeen onder hul portuurgroep in hul gemeenskap voorkom, hulle vergryp aan die heersende antisosiale praktyke nie. Dit wou voorkom asof hulle met ’n mate van sukses verby die uitdagings in hul ouerhuise en die gemeenskap genavigeer het. Vir hierdie leerders is die kweek van skolastiese praktyke in omstandighede wat nie bevorderlik daarvoor is nie, beslis nie eenvoudig nie. Hulle kon dit egter regkry om dit wel te doen. Dit het ’n merkwaardige uitwerking op hul identiteitsvorming gehad. In die volgende afdeling bied ons ’n beskrywing van hoe hierdie leerders se konstruksie van hul onderskeie identiteite aanleiding tot hulleerpraktykvorming gee.

 

5. Leerders se konstruksie van hul leeridentiteite en leerpraktykvorming

In die vorige afdeling het ons gekyk na hoe hierdie leerders se omstandighede op hul leerpraktykvorming inwerk. Hierdie afdeling fokus op hoe die leerders hul leeridentiteite konstrueer. Ons hou die argument voor dat die jeug met hul identiteitsvorming onderhandel en agentskap verwerf in verhouding tot die gemeenskap waarin hulle leef en deur hul alledaagse lewenservarings. Verder wil ons die aanname maak dat jongmense se leerpraktyke slegs in verhouding tot hoe hulle gestalte gee aan die tipe identiteite wat hulle aanneem, verstaan kan word. Volgens ons is daar ’n verwantskap tussen hul leerpraktyke en die identiteite wat hulle aanneem met betrekking tot hierdie praktyke.

In die Suid-Afrikaanse konteks wend Fataar (2009a:3) hom tot die teorieë van De Certeau (1984) en Lefebvre (1991) om insigte te bied in hoe die jeug se identiteitsvorming verstaan moet word, en meld dat “the youth ’walk’ through the landscapes that they inhabit and draw on a repertoire of internal and external resources.” Fataar (2009a:3) beweer dat dit die samevoeging van hierdie interne sielkundige hulpbronne en die materiële aangeleenthede van die eksterne omgewing is wat “points the way for their subjective becoming”.

Die leerders in hierdie studie moet ook op ’n daaglikse basis hul lewens en identiteite bou te midde van armoede. Grootword in hierdie arm woonbuurt is vir hierdie leerders om blootgestel te wees aan ’n verskeidenheid invloede buite die huis wat die vooruitsigte vir opvoedkundige sukses ondermyn. As oplossing hiervoor wend hierdie leerders hulle tot ’n verskeidenheid aktiwiteite wat hul identiteite beïnvloed. Dit is minder verwant aan hul onmiddellike oorlewing en meer aan die verbetering van hul eie welstand. Ons het egter waargeneem dat hierdie leerders met die werklikheid van hul identiteite handel deur “living in this global imaginary whereby they desire beyond their tangible realities to realise their aspirations in the thickness of difficult social lives and landscapes” (Appadurai 2004:67).

Hierdie leerders se leeridentiteit is met verloop van tyd ontwikkel deur die aanneem van ’n houding teenoor leer deur hul lewenservarings. Dit (hoe hulle leer) is ook konteksgebonde. Deur middel van hul konteks is ’n leeridentiteit ontwikkel wat diep deurdring is van alle aspekte van die leerder se lewenservarings. Wenger (1998:145) argumenteer dat “[b]uilding on identity consists of negotiating the meanings of our experiences of membership in social communities”. ’n Persoon se leeridentiteit word deur verskillende leerervarings saamgestel. Die manier waarop ervarings mekaar ondersteun en belemmer, word deur die samestelling teweeg gebring. Die waarde van subjektiewe ervarings van jouself as ’n leerder bepaal jou leeridentiteit. Die aanneem van ’n leeridentiteit vloei uit die evaluering, formulering en uiteindelik die voortdurende konstruksie van betekenis van jouself as ’n leerder. Hierdie aktiwiteite kan gerig wees op die doelwitte van leer, of nie. Leeridentiteitskonstruksie is gegrond op aktiwiteite waar daar ’n ervaring van leer is. Dit ontstaan in die geloof dat elke persoon uit sy/haar lewenservarings kan leer en ontwikkel. Diegene wat glo dat hulle kan leer en ontwikkel, het ’n leeridentiteit.

5.1 Ruby se konstruksie van haar leeridentiteite en leerpraktykvorming

Vir hierdie leerders is kultuur ’n betekenisvolle faktor in hul persepsies van wie hulle is en wat hulle wil leer. Dit het die aard van hul identiteite weergegee en gevorm. Ruby het beaam dat “[e]k dink kultuur is waarin jy gewortel is. Dit beskryf wie jy is.” Volgens haar is dit noodsaaklik om kulturele kennis te hê ten einde jouself te ken, te verstaan en te weet waartoe jy in staat is. Die meerderheid van die leerders was in staat om hulle eie unieke kultuur in besonderhede te beskryf. Vir hulle is kulturele kennis belangrik.

Namate ons gesprekke oor ervarings wat verband hou met die kultuur en die invloede van kultuur gevorder het, het die faktore van modernisering in gesprek gekom. Hierdie leerders ervaar gereeld die uitdagings van modernisering. Alhoewel hul gesinne nie gereeld in die Westerse kultuur betrokke is nie, is die leerders daartoe aangetrek. Die meeste ondervind ook probleme met die verwerking van die Westerse kultuur in die lig van hul meer tradisionele Afrika-kulture. Dit het ’n impak op hulle: “Jongmense is besig om te verander. Ons wil graag die fancy dinge wat ons op die TV sien hê. Ons skep nou ons eie kultuur. Sommige mense probeer om te verander. Dit is waarom hulle nie in hul kultuur glo nie“ (Ruby).

Duidelik uit Ruby se woorde is dat hul identiteite grotendeels deur die gebruik van populêre media gevorm word. Hulle ondervind probleme met die handhawing en verwerking van hul tradisionele kulture teenoor dít wat hulle op die televisie sien. Hulle kyk dikwels na programme wat onsinnig vir hul ouers is. Verder is hulle aangetrek tot baie aspekte van Amerikaanse populêre kultuur. Dit is veral die seuns wat ’n besondere liefde en passie het vir wat Ibrahim (1999) noem “Black popular culture” wat in die vorm van ’n hip-hop- en rap-kultuur vertoon word. Kenmerke van hierdie populêre kultuur is die bepaalde manier waarop die jeug mekaar groet, asook die musiek waarna hulle luister en hul maniere van aantrek, loop en praat (Ibrahim 1999:351). Dit is dikwels sigbaar in die houdings, die handdrukke en die liggaamlike intonasies wat hierdie kultuur kenmerk. In ons gesprek met Musa het hy dit duidelik gestel dat: “Dit is maar net ons manier van greet en die way hoe ons aantrek. Ons doen wat nodig is om te survive.”

Ibrahim (1999) wys daarop dat die jeug se betrokkenheid by hip-hop-kultuur geen toeval is nie. Dit is hul dade van weerstand en bewuste pogings om hul plekke van behoort tot en aanvaarding in die wêreld waar burgerskap nie meer geld nie, te vind. Ibrahim (1999:353) maak die aanname dat “these actions are articulations of the youths’ desire to belong to a location, a politics, a memory, a history, and hence a representation.” Hierdie leerders se optrede, persepsies en taalgebruik dien om hul identiteite op spesifieke maniere te posisioneer. Dit is hierdeur dat hulle verskillende ervarings bevraagteken wat verband hou met hul deelname, persepsies en identiteite wat in die woonbuurt aan hulle opgedring is. Op hierdie wyse dra hul leeridentiteite by tot die leerpraktyke wat hulle vorm.

5.2 Musa se konstruksie van sy leeridentiteite en leerpraktykvorming

Ons waarnemings van die geselekteerde leerders in die woonbuurt het getoon dat hulle oor die algemeen die reëls van wat dit verg om ’n goeie leerder te wees, nakom. Uit hul gesprekke was dit duidelik dat hulle self die verantwoordelikheid vir leer aanvaar. Hierdie leerders se leeridentiteite is gebou vanuit hul beperkende omstandighede, wat ook hul identiteit gedefinieer het. Dit (hul omstandighede) veroorsaak ook dat hulle hulself as leerders op ’n ander manier beskou. Musa het ons daarop gewys dat dit ’n bepaalde ingesteldheid en houding, sowel as ’n begrip van wat in elke situasie nodig is, verg om as leerder in die woonbuurt te floreer. Hy het gemeld:

Ek weet waarom ek wil leer. Ek vat dit op myself [neem eienaarskap van my eie leer]. Deur dit te doen, kan ek die dinge doen wat my laat voel dat dit wat ek leer myne [leerervaring] is. Dit maak dat ek wil aanhou. Ek weet wat my doelwitte is in die lewe en wat ek wil doen in die toekoms. Ek hou my net besig met my eie dinge. Ek sien baie goed hier wat jou kan verander.

Wat Musa in die woonbuurt ervaar, het meegebring dat sy ervarings die middelpunt van sy benadering tot leer geword het. Musa stel hoë standaarde aan homself, wat vir hom die fokuspunt is waarvolgens hy besluite neem met betrekking tot watter tipe leerder hy wil wees. Hy het vir homself ’n studierooster opgestel en bestee lang ure ná skool aan sy skoolwerk terwyl die meeste van sy portuurgroep hul tyd aan ontspanning wy. Vir Musa is dit belangrik om dit te doen, want op dié manier neem hy beheer oor wat hy wil leer en waarin sy lewe uiteindelik sal verander.

Die inwerking van hul identiteit op hul leerpraktyke het op ’n uitdagende wyse op hulle ingewerk. Musa het dit as volg verwoord: “Ek het geleer hoe om te dink. Die lewe hier is nie maklik nie. Ek sal moet hard leer om dit te verander. Ek weet hier diep binne my dat ek dit kan doen, maar ek moet leer.”

5.3 Tom se konstruksie van hul leeridentiteite en leerpraktykvorming

Tom, aan die ander kant, het beskryf hoe sy leeridentiteite gevorm is deur sy familie wat vir hom patrone van leer modelleer. Hulle het hom gehelp om sy lewe te prioritiseer. Saam het hulle vir hom ’n werkprogram (studierooster) opgestel. Hy het vertel:

My aunty moedig ons op baie maniere aan. Sy sê dat ons moet leer en hulle is eerlik met ons oor die samelewing buite. As daar ’n probleem in my huis is, praat sy openlik daaroor en sy sê vir ons wat reg en verkeerd is. Sy sê ons moet skool toe te gaan en sy vertel vir ons interessante stories. Verder help sy ons met die beplanning van ons toekoms.

Vir Tom net soos vir Musa is die belangrikheid en waarde van opvoeding beklemtoon. Verder het Musa en Tom dikwels genoem hoe hul ouers by tye aan hulle praktiese en intellektuele ondersteuning met hul skoolwerk bied. Die manier waarop hierdie leerders ruimtes om hul huise en in hul woonbuurtinteraksies gebruik om hul leeridentiteite te konstrueer, verskil. Hulle moes hul leeridentiteite bou met betrekking tot hul ideale in die karakter van hul woonbuurt en hul gemeenskap. Hul omstandighede het die wyse waarop hulle die woonbuurt verstaan, gevorm. Ten einde op sy leer gefokus te kan bly, moet Tom verskeie uitdagings oorbrug. Daar is min tye wanneer hy in ’n stil plek by die huis kan leer. Hy sê:

“Elke dag ... [is] ’n uitdaging. Daar is altyd iets wat gebeur. Ek leer nooit in die dag nie. Dit is moeilik om te konsentreer ... en buite is daar altyd harde musiek en ek kan nie konsentreer nie.”

Ten einde die moeilike omstandighede te bowe te kom, wend Tom hom tot sy sosiale netwerk, wat uit sy familie bestaan. Hulle sien hom as ’n leerder wat in ’n positiewe rigting beweeg. Deur by sy tannie se huis te gaan leer, waar dit stiller is, word die druk op hom as leerder verminder. Hierdie aanpassing was noodsaaklik vir Tom om op sy skoolwerk gefokus te bly.

Al die leerders in hierdie studie, droom dat opvoeding hulle beter kanse in die lewe sal bied. Vir hulle is die bekom van sodanige opvoeding egter nie so eenvoudig nie. Ten spyte van die feit dat hulle hulself as “goeie leerders” beskou, kategoriseer Cherry, Ruby, Musa en Sally hulself ook as “sukkelende leerders” weens die impak van hul lewensomstandighede.

Om hierdie beperking te oorkom, het hierdie leerders by verskeie sosiale netwerke ingeskakel. Deur hierdie strategie te ontplooi, het hulle hul leeridentiteite aan hierdie sosiale netwerke gekoppel. Dít het aan ons die belangrikheid van die rol van sosiale netwerke in die vestiging van ’n leeridentiteit in die leerders se lewens bevestig. Hulle kan byvoorbeeld dikwels via Facebook en Mxit hulle vriende vra watter vrae hulle nog vir ’n toets of eksamen moet leer. Hul sosiale netwerke stel hulle in staat om in kontak te bly met ander ten spyte daarvan dat hulle fisies geskei is. Dit het by hulle die behoefte om aan mekaar gekoppel te bly en ’n gevoel van behoort aan ’n leernetwerk laat ontstaan. Musa het genoem dat “[e]k chat [gesels op sosiale netwerke], ek dink dit help my op ’n manier dat wanneer ek by die huis is, dan voel ek asof ek nog steeds met my vriende is, asof hulle hier langs my sit. Ons ruil sommer ook dan inligting uit.”

Die fokus van hierdie afdeling was om te verstaan hoe hierdie vyf kinders se onderskeie identiteite in hul woonbuurt op hul leerpraktykvorming inwerk. Onderliggend hieraan was ’n begrip van hoe hulle hul leeridentiteite in hul fisiese leefruimtes bou. Verder wou ons ontbloot hoe hulle hul leeridentiteite ontwikkel en dit regkry om die bepaalde leerpraktyke wat hulle ontplooi, te gebruik ten einde op koers te bly in die nastreef van hul opvoedkundige doelwitte.

 

6. Die invloed van die leerders se leeridentiteitsposisionering op hul leerpraktyke

Hierdie artikel kyk in die besonder na hoe leerders hul leerpraktyke konstrueer te midde van hul alledaagse leerervarings in die veelvuldige kontekste van hul lewens. Ons het gekyk na hoe eienskappe vanuit hul plaaslike sosiale realiteite op hul leeridentiteite inwerk. Hierdie afdeling fokus op hoe hulle in die besonder hul leeridentiteite in die beperkte ruimtes van hul huise en gemeenskap posisioneer. Ons fokus op die kreatiewe aanpassings wat hulle maak in hul stryd om te oorleef ten einde hul leeridentiteite op spesifieke maniere te posisioneer. Met leerposisionering verwys ons na die maniere waarop hulle hulself posisioneer met betrekking tot hul benadering tot hul leer, die leeridentiteite wat hulle in hul woonbuurt aanneem en weerspieël, en hoe hulle die dinamika van die woonbuurt ontvang en hulself as ’n spesifieke tipe leerder posisioneer (Fataar en Du Plooy 2012:1). Hierdie posisionering is sentraal tot die konstruering van hul leerpraktyke.

Ons gee in die besonder aandag aan die maniere waarop prosesse van leer verweef is met prosesse van leeridentiteitsposisionering. Ons sleutelargument sluit aan by en bou op dié van Fataar en Du Plooy (2012) dat hul leerposisioneringspraktyke saamgestel word uit verskeie en oorvleuelende sosioruimtelike samestellings en leeronderdrukkings in en oor die gebiede van hul lewens heen. Fataar en Du Plooy (2012:3) verwys na sosioruimtelike samestellings as “messy and incoherent ‘putting together’ processes of various discursive practices and materials in specific domains, and [...] the way that these practices intersect and overlap to produce the students’ specific learning positioning identifications”. Verder gebruik Fataar en Du Plooy (2012) die woord onderdrukking as “a referent for a situation where one type of spatial practice serves as a kind of constraint or suppressor of other positioning practices in the same domain”.

Wortham (2004), wie se hooffokus die ontwikkeling van sosiale identiteite is, verduidelik die dualisme tussen die verandering en die konsekwentheid van identiteite deur te onderskei tussen “posisionering” en Holland en Lave (in Wortham 2004) se konsep van “verdikking”. Posisionering is “an event of identification, in which a recognizable category of identity gets explicitly or implicitly applied to an individual in an event that takes place across seconds, minutes or hours” (Wortham 2004:166). Verdikking, aan die ander kant, kom voor wanneer ’n individu herhaaldelik op ’n sekere manier in die verskillende kontekste en tydskale geïdentifiseer word. Terwyl posisionering konteksgebonde is, het verdikking te doen met hoe ’n persoon oor kontekste beweeg. Dit is gegrond op min of meer gevestigde sosiokulturele patrone van erkenning van ’n persoon en ander mense se kennis van hul omstandighede. Posisionering kan op verrassende maniere voorkom, na gelang van die konteks, maar vroeër of later vind ’n proses van verdikking plaas.

Op die oppervlak het dit geblyk dat hierdie leerders almal ’n eenvormige identiteit as graad 10-leerders in ’n spesifieke omgewing het. Uit ons vorige besprekings is dit duidelik dat dit hierdie leerders se komplekse beliggamingspraktyke in hul sosiale omstandighede is wat die omstandighede skep waarin hul leer plaasvind. Dit is hierom dat ons die leerders nie buite hul konteks kan sien nie, want die realiteite van hul lewe is hierdeur geskep. Namate ons in die woonbuurt saam met die leerders rondbeweeg het, het die impak van hul beweging in en oor hul leefruimtes heen ons veral geïnteresseer. Ten spyte van die feit dat hulle in dieselfde omgewing bly, verskil hul ervarings in, en interaksie met, hul omgewing. Dit het ons ons aandag laat vestig op die gehalte van die verhoudings en netwerke wat hulle gestig het, hul mobilisering van en interaksie met leer en verwante hulpbronne, en hul eweknie- en gesinsgebaseerde praktyke. Hul beweeglikheid in die woonbuurt bied aan hulle groter geleenthede vir die leer van verskillende dinge.

6.1 Cherry se leeridentiteitsposisionering op haar leerpraktyke

Cherry woon die verste van die skool op ’n plaas. Sy droom daarvan om ’n onderwyseres of maatskaplike werkster te word. Haar dag begin reeds om 05:30, want sy moet die bus om 07:00 haal om by die skool te kom. Op haar rit na en van die skool moet sy deur twee gegoede buurte reis. Haar leerposisionering is deels gevorm deur haar waarnemings van en blootstelling aan hierdie middelklasbuurte. Haar daaglikse interaksie met kinders vanuit verskillende agtergronde tydens hierdie reise het haar ’n groter perspektief gegee op die lewe buite die beperkinge van die lewensomstandighede op die plaas. In haar kamer het sy prente geplak van hoe haar lewe eendag daar sal uitsien om haar elke dag aan haar droom te herinner. Met hierdie droom gaan sy elke dag skool toe.

Vir Cherry is haar huislike omstandighede die dryfkrag agter die rede waarom sy leer. Haar daaglikse reis het tot gevolg gehad dat daar by haar ’n “ruimtelike ontwrigting” ontstaan het. Met ruimtelike ontwrigting verwys ons na die vervreemding van en ontevredenheid met haar “plek” en haar lewe op die plaas, soos verwoord deur Fataar en Du Plooy (2012). Dít wat Cherry sien, het haar ’n middelklas-tipe aspirantpersona laat aanneem, want sy het genoem: “Ek wil ook so ’n groot huis en die mooi dinge wat hulle het hê.”

Verder is sy ook ontevrede met die kultuur wat by hulle op die plaas heers. Cherry doen dikwels saam met vriende in haar klas take in die biblioteek wat in een van hierdie gebiede geleë is. By sulke geleenthede vergesel Cherry haar vriende dikwels na hul huise. Cherry se blootstelling aan ’n middelklasomgewing, haar houdings, oortuigings en maniere van dinge doen het die manier waarop haar leerpraktyke gevorm is, gerig.

Cherry sien haarself ook as volg:

Geduldig, gee om vir ander en probeer om ander te verstaan. Ek plaas myself altyd in ander mense se situasies en luister na hul menings. Ek is nie selfsugtig nie. Ek het altyd probeer om ander mense te help. Om arm te wees, beïnvloed my gedagtes en hoe ek leer. Dit help my om harder te werk. Maar ek het nog baie dinge om te leer en om te ontdek.

Dit is hierdie eienskappe wat haar aanvuur om te leer. Dit het haar baie nederig en realisties gemaak. Sy aanvaar nooit dinge en mense as vanselfsprekend nie. Dit het volgens Cherry van haar ’n “harde werker gemaak het, wat dit geniet om te leer. Dit prikkel ook my nuuskierigheid vir nuwe inligting wat belangrik is van hoe ek myself sien as ’n leerder.” Verder het dit haar geloof in haar vermoë om op skool goed te doen en die gewenste sukses te behaal, versterk.

Vir Cherry was die rol van haar persoonlike konteks ook belangrik in hoe sy haar met betrekking tot haar leerpraktyke posisioneer. Haar jeugdige identiteitskonstruksies is verwoord deur die voorwaardelike sosiale ruimtelike dinamika wat sy in haar leefwêreld ervaar. Dit het haar leer ook op dié manier geposisioneer:

Meneer weet elke keer as jy sien iemand probeer om te verander, sal mense hom altyd probeer afdruk. Ek bedoel by die skool en hier in die buurt probeer ek om anders op te tree, alhoewel die omstandighede waaruit ek kom nie so goed is nie. Ek doen alles met dieselfde ingesteldheid.

6.2 Tom se leeridentiteitsposisionering op sy leerpraktyke

In teenstelling met Cherry, wat daagliks reis, is Tom se beweging redelik beperk tot binne die woonbuurt, hoewel hy dit by tye verlaat. Tom beweeg gereeld tussen die huis, die skool en ander instellings wat hy as veilig beskou. Van ’n vroeë ouderdom af het hy geleer om aan te pas by die veranderende plaaslike omstandighede. Tom wend hom dus tot binnenshuise aktiwiteite om homself besig te hou. Hy het daardeur aktief betrokke geraak by inligtingstegnologie (IT) (soos selfoon-, rekenaar- en videospeletjies). Tom se interaksie met die IT-verwante populêre kultuur bied aan hom ’n verskeidenheid ryk en aanpasbare geletterdheidsbates. Hy gebruik sosiale netwerke (soos Mxit) om met sy maats te kommunikeer en sodoende idees of kommentaar oor behandelde werk te wissel. Hy en sy vriende kom ook gereeld bymekaar om afgehandelde inhoude met betrekking tot hul skoolwerk te bespreek. Ná so ’n geselssessie of met die insette van ander vriende kan hy meestal ’n begrip van leerinhoude opbou. Hierdeur het hy ook blywende netwerke wat noodsaaklik is vir sy leer- en geletterdheidspraktyke gevorm. Nespor (1997:169) stel dat hierdie tipe leerpraktyke beskryf kan word as “kids-based funds of knowledge”, wat hulle in hul konteks mobiliseer en help om lewensvatbare geletterdheid en leerpraktyke te vestig. Tom se vaardigheid in die IT-gebaseerde populêre kultuur is die manier waarop hy in hierdie beperkende omgewing met sy leerpraktyke onderhandel. Hy verskil dus van Cherry, wat stimulasie vind in haar aspirantmiddelklasinteraksies tydens haar daaglikse reise deur middelklasbuurte.

6.3 Ruby se leeridentiteitsposisionering op haar leerpraktyke

Net soos Tom is ook Ruby aktief betrokke by IT-verwante aktiwiteite nadat haar pa vir hulle ’n rekenaar gekoop het en dit aan die internet gekoppel het. Ruby het tydens ons besoek aan hul huis die volgende vertel:

Meneer sien die computer wat my pa nou vir ons gekoop het [sy wys na die rekenaar wat op ’n kassie staan]. Vandag is alles ge-computerise. Indien jy nie die nodige kennis van computers het nie dan gaan jy nie ’n goeie werk kry nie. Ek gee ook nou ekstra aandag aan my Engels, want alles word ook nou Engels.

Ruby beskou haar vertroudwording met rekenaars as ’n manier om die strukturele struikelblokke tot haar vooruitgang in ’n toenemend geglobaliseerde wêreld te oorkom. Haar aktiewe betrokkenheid by hierdie verwante netwerkaktiwiteite stel haar in staat om daagliks te kommunikeer en die gesofistikeerde geletterdheidsvorme wat met IT verband hou, te beoefen. Dit bied ook aan haar die geleentheid om haar Engels op te knap. Ruby het ook gereeld aangeleenthede oor skool- en buiteskoolverwante temas via webwerwe soos Google ondersoek. Dit is hierdie kombinasie van nie-amptelike, buiteskoolse geletterdheidsnetwerke en praktyke wat die dryfveer vir Ruby se leerprestasies is.

6.4 Sally se leeridentiteitsposisionering op haar leerpraktyke

Die woonbuurt het ook ’n groot invloed gehad op hoe Sally haar leerpraktyke gevorm het en haarself dienooreenkomstig geposisioneer het. Sally se ervarings is gevorm deur ’n mengsel van sosiale praktyke. Hierdeur het sy begin om aktief haar eie agentskap in haar omgewing te kweek. Sy was in staat om die formele en informele netwerke van hierdie dorp tot haar voordeel te laat werk. Terwyl sy gefokus bly op haar skoolwerk, neem sy ook aan die godsdienstige, welsyns- en jeugaktiwiteite van die kerk deel. Sally het haar verder ingedompel in die kerk se maatskaplikewelsyn-aktiwiteite in die dorp. Sy woon getrou kerkdienste by en neem aan die jeugprogramme deel. Die kerkomgewing het haar ook die geleentheid gebied om betrokke te raak by drama. Haar godsdienstige verpligtinge het by haar ’n sekere begrip van die lewe gegenereer. Dit het haar die breër moontlikhede wat inherent beskikbaar sou wees indien sy deurlopend daaraan deelneem, laat verstaan. In haar kerkkonteks kan sy haar leer positief posisioneer en uitleef. Dit is hier waar Sally meer aktief betrokke geraak het by die geleenthede wat in hierdie ruimte aangebied is. Sy het probleme ondervind met die vestiging van roetines in die woonbuurt, want sy het genoem:

Ek maak moeilik vriende hier. Was dit nie vir die kerk nie ... dan weet ek nie. Ek dink dit is nie goed hier nie. Alhoewel die kinders vandag meer regte het, moet ons ook gebruik maak van ons kanse. Dit is die rede waarom ek gedissiplineerd is. Dit gaan oor selfrespek en selfdissipline.

Dyers (2009:5) vang die verhouding tussen woonbuurtlewe en gevoelens van vervreemding vas deur daarop te wys dat “township life frequently poses severe challenges to aspects such as family cohesion, parental control and the exercise of traditional practices and values.”

6.5 Musa se leeridentiteitsposisionering op sy leerpraktyke

Musa kan hom nie vereenselwig met dít wat in die woonbuurt gebeur nie. Hy voer aan:

Hulle is lui. Ek is anders [as hierdie leerders] omdat ek weet wat ek wil doen. Hulle weet nie wat hulle wil doen nie. Selfs al kry hulle die nodige leiding, gee hulle nie om nie. Dit wil voorkom asof hulle dit sien as ’n vermorsing van tyd. Maar ek weet ek kan dit doen en ek sal dit doen en ek sal eendag ’n beter lewe lei.

Musa glo dat dit die ander leerders se gebrek aan selfrespek en selfdissipline is wat dikwels tot hul bepaalde optrede en hul benadering tot die lewe lei.

Verder is liggaamlike dissipline vir hom ’n belangrike aanpassingstrategie. Hy raak nooit betrokke by gevegte en ander negatiewe aspekte in die woonbuurt nie, alhoewel hy dikwels deur ander seuns daartoe uitgedaag word. Hierdie persepsie van homself is die gevolg van ’n eerbiedige en hulpvaardige houding en van respek teenoor ander. Sy persoonlikheid is die sleutel tot hoe hy sy leer benader. Musa het hom gewend tot sport om uiting te gee aan sy persoonlikheid. Van ’n jong ouderdom af was hy lief vir sport en dit was deur middel van sport dat hy sy teenwoordigheid sigbaar gemaak het. Hier kon hy mense vermaak, wat hom gunstig in die verskillende ruimtelike arenas geposisioneer het. Hier het hy sy eie styl van dinge doen gekweek in die lig van die groter sosiale verhoudings en netwerke. Sy interaksie met ’n wye verskeidenheid instellings, vriende en rolspelers in verskeie gemeenskappe het aan hom ’n platform gebied om betrokke te raak by sy leer. Hier het hy ook die persoonlike vereistes vir sy eie sosiale vooruitgang begin verstaan. In teenstelling met die beperkte horisonne van sy woonbuurt bied sy reise wanneer hulle teen ander spanne buite die dorp speel aan hom ’n sosiale konteks waarin hy sy persoonlike ambisies kan kweek. Dit verklaar sy aktiewe en volgehoue soeke na ’n geleentheid, want “ek wil soos Brian Habana wees. Ek wil ook ’n rugbykontrak in die buiteland hê.”

Alhoewel sy skoolopleiding ’n belangrike rol in sy lewe speel, is dit weens sy vermoë om verskeie sosiale prosesse en praktyke in sy lewensruimtes te gebruik wat deurslaggewend is in die aankweek van sy ambisies. Musa moes leer hoe om met verskillende verwagtinge van aanvaarbare gedrag in verskillende omstandighede te onderhandel. Deur dít wat in verskillende omgewings van hom verwag word om suksesvol te wees, het hy die vaardighede van hierdie nuwe verwagtinge in elke ruimte ontwikkel. Hy het dit gedoen op die grondslag van die weerspieëling van sensitiwiteit vir die sosiale gewoontes in elke ruimte. Sy vermoë om elke ruimte te lees is opgebou deur vinnig te leer wat die grense van aanvaarbare gedrag is, en hoe om homself gunstig in hierdie beperkings te posisioneer. Deur Musa se betrokkenheid by die plaaslike rugbyklub kry hy baie oefening in wat die aanvaarbare gedrag in ander omgewings is indien hy hom in ’n ander omgewing en ander omstandighede sou bevind.

Ter kommentaar op hul werk onder die werkersklasjeug in ’n Kanadese stad stel Dillabough, Kennelly en Wang (2008:343) die volgende voor:

Young people who are tied to particular geographical spaces might be seen as engaging in “classification struggles” over the social meaning of being young. ... This shapes the ways in which young people construct cultural meanings of everyday life and education, creating perhaps more (rather than less) anxiety about their ability to perfect themselves for an imagined future in new times.

Hierdie klassifikasiestryd om oorlewing en om hulself te probeer bevry van hul woonbuurtbeperkinge is ook vir die leerders in ons studie ’n daaglikse stryd. Ruby het gesê: “Hulle [die ander kinders] gee nie om oor hul skoolwerk. Maar ek het gedink, dit is nie my probleem nie en ek moet net my werk doen. Vir my is dit baie sleg as jy nie weet hoekom jy skoolgaan nie.”

Cherry, Ruby, Musa, Tom en Sally het hul onderskeie sosiale kontekste strategies gelees ten einde suksesvol met hul leerpraktyke te onderhandel. Hulle is bewus van watter gedrag aanvaarbaar is en tree daarvolgens op. Ons kon sien en aanvoel dat hierdie leerders ’n gedeeltelike verbintenis met hul huidige geleefde omstandighede het. Dit moedig hul verbintenis tot opvoeding aan. Wat hulle beleef, het tot veerkragtigheid gelei in hul mobilisering na wat Yosso (2005) “aspirational capital” noem. Volgens Yosso is aspirerende kapitaal kinders se vermoë om drome vir die toekoms te handhaaf, selfs in die aangesig van hul werklike en vermeende hindernisse. Hul leerposisionering is toekomsgerig en doelgerig, ten spyte van die beperkings in hul woonbuurt.

In hierdie afdeling het ons die omvang van die weë wat hierdie leerders koppel aan die praktyke met betrekking tot hul leeridentiteitsposisionering uitgelig. Wat hierdie leerders teëkom, is die verskillende vlakke van toegang tot die hulpbronne vir hul identiteitsontwikkeling wat fokus op die ontleding van hul leeridentiteitsposisionering. Ons het getoon dat hierdie leerders se identiteitsweë met verloop van tyd kan verskuif namate hulle hul leer posisioneer. Hul persoonlike verhouding met die woonbuurt en die leerders in die woonbuurt is sentraal in die bepaling van hul toegang tot materiële en ander hulpbronne, soos dié waarin onderrig en leer plaasvind met betrekking tot hul leeridentiteitsposisionering.

 

7. Samevatting

Hierdie artikel het gefokus op ’n beskrywing van hoe arm, plattelandse werkersklasleerders hul leerpraktyke vorm in hul geleefde ruimtes buite die skool. Die artikel het ten doel gehad om die leerervarings van hierdie werkersklasleerders in hul geleefde werkersklaskonteks in oënskou te neem. ’n Verdere fokus was op hoe hulle in die besonder hul leeridentiteite in die beperkte ruimtes van hul huise en hul gemeenskap posisioneer. Met hierdie fokus het ons gekonsentreer op die kreatiewe aanpassings wat hulle moes maak in hul stryd om te oorleef ten einde hul leeridentiteite op spesifieke maniere te posisioneer. Ons het in die besonder aandag gegee aan die maniere waarop prosesse van leer verweef is met prosesse van leeridentiteitsposisionering. Ons sleutelargument het aangesluit by en gebou op dié van Fataar en Du Plooy (2012), naamlik dat die deelnemers se leerposisioneringspraktyke saamgestel word uit verskeie en oorvleuelende sosioruimtelike samestellings en leeronderdrukkings in en oor die gebiede van hul lewens heen. Met leeridentiteitsposisionering het ons verwys na die maniere waarop hulle hulself geposisioneer het met betrekking tot hul benadering tot hul leer, die leeridentiteite wat hulle in hul woonbuurt aanneem en weerspieël, en hoe hulle die dinamika van die woonbuurt ontvang en hulself as ’n spesifieke tipe leerder posisioneer (Fataar en Du Plooy 2012:1).

’n Komplekse verhouding tussen hul fisiese en sosiale ruimtes het die opvoedkundige ervarings en posisionering van die leerders in hierdie studie bemiddel. Hierdie artikel het getoon dat ’n begrip van leerders se sosiale lewe buite die skool baie belangrik is vir ’n begrip van die leerders se ervarings van hoe hulle betrokke gaan raak by hul leerpraktyke en hoe hulle dienooreenkomstig hul leeridentiteite gaan posisioneer. Die deelnemers was dit eens dat hulle, ten spyte van hul beperkte omstandighede, steeds produktiewe lewens lei. Dit was interessant dat, ten einde hul leeridentiteite suksesvol te vestig, hulle hulle nie vergryp aan antisosiale praktyke soos dit algemeen onder hul portuurgroep in hul gemeenskap voorkom nie. Dit wou voorkom asof hulle met hul leeridentiteitsuksesse verby die uitdagings in hul ouerhuise en die gemeenskap onderhandel het. Volgens ons is die persoonlike verhouding tussen die woonbuurt en die leerders sentraal in die bepaling van hul toegang tot materiële en ander hulpbronne, soos dié waarin onderrig en leer plaasvind met betrekking tot hul leeridentiteitsposisionering.

Hierdie leerders se leer is gevorm en geïnspireer deur en uit hul weiering om hul huidige omstandighede te aanvaar. Verder het hulle deeglik besin oor hoe hulle hulself as leerders definieer. Hierdie leerders se identiteite is gebou vanuit hul beperkende omstandighede, wat ook hul leeridentiteit gedefinieer het. Die konseptuele fokus van die artikel was om te verstaan hoe werkersklasjeugdiges in hul woonbuurtkonteks met hul leerervarings onderhandel in die nastrewing van hul opvoedkundige doelwitte. Onderliggend hieraan was begrip van hoe hul fisiese leefruimtes daarop inwerk, hoe hulle hul leeridentiteit ontwikkel het en dit reggekry het om beter toekomste te kan visualiseer, asook die bepaalde beliggaamde praktyke wat hulle ontplooi ten einde op koers te bly in die nastreef van hul doelwitte.

 

Bibliografie

Andrande, A.D. 2009. Interpretive research aiming at theory building: Adopting and sdapting the case study design. The Qualitative Report, 14(1):42–60.

Appadurai, A. 2004. The capacity to aspire: Culture and the terms of recognition. In Rao en Walton (reds.) 2004.

Barbarin, O.A. en L.M. Richter. 2001. Mandela's children: Growing up in post-apartheid South Africa. New York: Routledge.

Bourdieu, P. 1977. Outline of a theory of practice. Cambridge: Cambridge University Press.

—. 1979. The disenchantment of the world: The sense of honour: The Kabyle House or the world reversed: Essays. Cambridge: University Press.

—. 1986. The forms of capital. In Richardson (red.) 1986.

—. 2006. The forms of capital. In Lauder, Brown, Dillabough en Halsey (reds.) 2006.

Bourdieu, P. en J.C. Passeron. 1977. Reproduction in education, society and culture. Londen: Sage.

Bourdieu, P. en L. Wacquant. 1992. An invitation to reflexive sociology. Chicago: The University of Chicago Press.

Clark, J. 2008. Research methods. Paper presented at The University of the Western Cape to postgraduate students. (Ongepubliseerd.)

De Certeau, M. 1984. The practice of everyday life. Berkeley: The University of California Press.

Denzin, N.K. en Y.S. Lincoln. 2003. Handbook of qualitative research. Londen: Sage.

De Vos, A.S., H. Strydom, C.B. Fouché, M. Poggenpoel, E. Schurink en W. Schurink. 2005. Research at grass roots: A primer for caring professions. Pretoria: Van Schaik.

Dillabough, J., J. Kennelly en E. Wang. 2008. Spatial containment in the inner city: Youth sub-cultures, class conflict, and geographies of exclusion. In Weis (red.) 2008.

Dyers, C. 2009. From “ibharu” to “amajoin”: Translocation and language in a new South African township. Language and Intercultural Communication, 9(4):256–70.

Fataar, A. 2007. Schooling, youth adaptation and translocal citizenship across the post-apartheid city. Journal of Education, 42:1–28.

—. 2009a. Schooling subjectivities across the post-apartheid city. African Education Review, 6(1):1–18.

—. 2009b. Youthful becoming and rural-urban mobility: The case of Fuzile Ali at a Muslim community school in Cape Town. Southern African Review of Education, 15(2):105–17.

—. 2010. Youth self-formation and the “capacity to aspire”: The itinerant “schooled” career of Fuzile Ali across post-apartheid space. Stellenbosch: Sun Press.

Fataar, A. en L. du Plooy. 2012. Spatialised assemblages and suppressions: The learning ”positioning” of Grade 6 students in a township school. Journal of Education, 55:1–27.

Fillies, H. 2015. Die konstruering van hoërskoolleerders se leerpraktyke binne ’n werkersklaswoonbuurt. Ongepubliseerde PhD-verhandeling, Universiteit Stellenbosch.

Fillies, H. en A. Fataar. 2015. Doksa en verwerkliking van leeridentiteitspraktyk van hoërskoolleerders in ’n landelike werkersklasdorp. http://www.litnet.co.za/doksa-en-verwerkliking-van-leeridentiteitspraktyke-van-hoerskoolleerders-in-n-landelike-werkersklasdorp/ (21 Januarie 2016 geraadpleeg).

Giroux, H.A. 2009. Youth in a suspect society: Democracy or disposability? New York: Palgrave Macmillan.

González, N. 2005. Beyond culture: The hybridity of funds of knowledge. In González, Moll en Amanti (reds.) 2005.

González, N., L.C. Moll en C. Amanti (reds.). 2005. Funds of knowledge: Theorizing practices in households, communities, and classrooms. Mahwah, New York: Lawrence Erlbaum.

Ibrahim, A. 1999. Becoming black: Rap and hip-hop, race, gender, identity, and the politics of ESL learning. TESOL Quarterly, 33(3):249–69.

Jenkins, R. 2002. Pierre Bourdieu. 2de uitgawe. Londen: Routledge.

Lauder, P. Brown, J.A. Dillabough en A.H. Halsey (reds.). 2006. Education, globalisation and social change. Oxford: Oxford University Press.

Lefebvre, H. 1991. The production of space. Oxford: Blackwell.

Lingard, B. en P. Christie. 2003. Leading theory: Bourdieu and the field of educational leadership: An introduction and overview to this special issue. International Journal, Leadership in Education, 6(4):317–33.

Marshall, C. en G.B. Rossman. 2006. Designing qualitative research. 4de uitgawe. Londen: Sage.

Masoetsa, S. 2011. Eating from the one pot: The dynamics of survival in poor South African households. Johannesburg: Wits University Press.

Nespor, J. 1997. Tangled up in school: Politics, space, bodies and signs in the educational process. Londen: Laurence Erlbaum.

Pieterse, E. en F. Meintjies (reds.). 2004. Voices of Transition: The Politics and practices of social change in South Africa. Kaapstad: Heinemann.

Portes, A. en R.G. Rumbaut. 2006. Immigrant America: A portrait. Berkeley, Kalifornië: University of California Press.

Ramphele, M. 2002. Steering by the stars: Being young in South Africa. Kaapstad: Tafelberg.

Rao, V. en M. Walton (reds.). Culture and public action. Kalifornië: Stanford University Press.

Reay, D. 2004. It’s all becoming a habitus: Beyond the habitual use of habitus in educational research. British Journal of Sociology of Education, 25(4):431–44.

Richardson, J.G. (red.). 1986. Handbook of theory and research for the sociology of education. New York: Greenwood.

Soudien, C. 2004. Fighting for a normal life: Becoming a young adult in the new South Africa. In Pieterse en Meintjies (reds.) 2004.

—. 2007. Youth identity in contemporary South Africa: Race, culture and schooling. Kaapstad: New African Books.

Spradley, J. 1979. The ethnographic interview. New York: Holt, Rinehart & Winston.

Swartz, S. 2009. iKasi: The moral ecology of South Africa’s township youth. Johannesburg: Wits University Press.

Weis, L. (red.). 2008. The way class works: Readings on school, family and the economy. New York, Londen: Routledge.

Wenger, E. 1998. Communities of practice: Learning, meaning, and identity. Cambridge: Cambridge University Press.

Willis, P. 1977. Learning to labor. New York: Columbia University Press.

Wortham, S. 2004. From good student to outcast: The emergence of a classroom identity. Ethos: Journal of the Society for Psychological Anthropology, 32:164–87.

Yosso, T.J. 2005. Whose culture has capital? A critical race theory discussion of community wealth. Race, Ethnicity and Education, 8(1):69–91.

  • 1

Kommentaar

  • I applaud these academics for shining the spotlight on one of the most vexed issues in education, i e the Education of poor rural kids. The article shows how these kids aspire for a better life, and, how educational institutions are unable to recognize their learning practices and commitments. Dis fantastiese akademiese werk mense.

  • Reageer

    Jou e-posadres sal nie gepubliseer word nie. Kommentaar is onderhewig aan moderering.


     

    Top